DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and Ppp1r2

DIOPT Version :10

Sequence 1:NP_609828.2 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_080076.1 Gene:Ppp1r2 / 66849 MGIID:1914099 Length:206 Species:Mus musculus


Alignment Length:172 Identity:44/172 - (25%)
Similarity:76/172 - (44%) Gaps:36/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTKRTRFDKMNLGVPVH--------------SDPYE---VENESASSIKRETGEKVMSHKELME 48
            ::.|..::|:||:....|              :.||.   .::|.|.|  ...|.:||:...|.:
Mouse    41 LSKKSQKWDEMNILATYHPADKDYGLMKIDEPNTPYHNMIGDDEDAYS--DSEGNEVMTPDILAK 103

  Fly    49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
            || ...:.:.|.:...:...|.::..|.    :.:||.::..|..:|||||.|...::|||:||.
Mouse   104 KL-AAAEGSEPKYRTREQESSGEEDNDL----SPEEREKKRQFEMKRKLHYNEGLNIKLARQLIS 163

  Fly   114 EEFTESSESQLSVDDEHISEIAE------EECPPCGTDSDDL 149
            ::..:..|      ||.::|.|:      ||.....|.||.|
Mouse   164 KDLHDDDE------DEEMAETADGDSMNVEESSQGSTTSDHL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_609828.2 IPP-2 <18..115 CDD:461504 29/113 (26%)
Ppp1r2NP_080076.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Required for binding PPP1CC 12..17
Required for binding the 'RVXF' binding groove of PPP1CC 44..56 4/11 (36%)
IPP-2 46..165 CDD:461504 32/125 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..143 17/74 (23%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity 148..151 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..206 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.