DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and PPP1R2

DIOPT Version :10

Sequence 1:NP_609828.2 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001278433.1 Gene:PPP1R2 / 5504 HGNCID:9288 Length:206 Species:Homo sapiens


Alignment Length:207 Identity:48/207 - (23%)
Similarity:77/207 - (37%) Gaps:58/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTKRTRFDKMNLGVPVH--------------SDPYEV---ENESASSIKRETGEKVMSHKELME 48
            ::.|..::|:||:....|              |.||..   ::|.|.|....|  :.|:...|..
Human    40 LSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEAT--EAMAPDILAR 102

  Fly    49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
            ||.....| .|.:...:...|.::..|....|..|::.:   |..:|||||.|...::|||:||.
Human   103 KLAAAEGL-EPKYRIQEQESSGEEDSDLSPEERGKKKRQ---FEMKRKLHYNEGLNIKLARQLIS 163

  Fly   114 EEFTESSESQLSVDDEHISEIAEEECPPCGTDSDDLLPYFQYDRATDQSMISDDSLPKEDPEPGF 178
            ::..:..|      ||.:.|.|:.|                             |:..|:...|.
Human   164 KDLHDDDE------DEEMLETADGE-----------------------------SMNTEESNQGS 193

  Fly   179 HPAHHCYNKLIS 190
            .|:....|||.|
Human   194 TPSDQQQNKLRS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_609828.2 IPP-2 <18..115 CDD:461504 30/113 (27%)
PPP1R2NP_001278433.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 0/3 (0%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 4/11 (36%)
IPP-2 45..165 CDD:461504 33/125 (26%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 148..151 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..206 14/77 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.