Sequence 1: | NP_001260525.1 | Gene: | CG12620 / 35034 | FlyBaseID: | FBgn0032626 | Length: | 287 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001278433.1 | Gene: | PPP1R2 / 5504 | HGNCID: | 9288 | Length: | 206 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 77/207 - (37%) | Gaps: | 58/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTTKRTRFDKMNLGVPVH--------------SDPYEV---ENESASSIKRETGEKVMSHKELME 48
Fly 49 KLHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIR 113
Fly 114 EEFTESSESQLSVDDEHISEIAEEECPPCGTDSDDLLPYFQYDRATDQSMISDDSLPKEDPEPGF 178
Fly 179 HPAHHCYNKLIS 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12620 | NP_001260525.1 | IPP-2 | <21..111 | CDD:282789 | 26/92 (28%) |
PPP1R2 | NP_001278433.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | 0/3 (0%) | |
Required for binding PPP1CC. /evidence=ECO:0000250 | 12..17 | ||||
Required for binding PPP1CC. /evidence=ECO:0000250 | 43..55 | 4/11 (36%) | |||
IPP-2 | 45..164 | CDD:282789 | 33/124 (27%) | ||
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 | 148..151 | 2/2 (100%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 164..206 | 14/77 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4041 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1321970at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003529 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12398 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |