DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and LOC497940

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006246839.1 Gene:LOC497940 / 497940 RGDID:1563007 Length:460 Species:Rattus norvegicus


Alignment Length:102 Identity:22/102 - (21%)
Similarity:38/102 - (37%) Gaps:19/102 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FHPAHHCYNKLISQTPDPPIVYVPAEPEPQPEPQPEPPVEPRPEPEPEPEPETVLPPTAPEVIDK 242
            :|||...|.            ::.|:       :|..|.....:.:.:|..|:.|..|...|.::
  Rat   163 YHPADKDYG------------FMKAD-------EPRTPYHRLQDNDEDPSAESSLKVTPESVAER 208

  Fly   243 TAPEEEKHTRVLDRGENIDLKNLSAIQKNISSSVKKH 279
            .|..:....:||..|:|.:.|......|..|:...||
  Rat   209 FATMDNFLPKVLQYGDNKNSKTTDNFTKTHSTDFDKH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789
LOC497940XP_006246839.1 IPP-2 152..257 CDD:282789 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.710

Return to query results.
Submit another query.