DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and ppp1r2

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_991231.1 Gene:ppp1r2 / 402967 ZFINID:ZDB-GENE-040426-1814 Length:204 Species:Danio rerio


Alignment Length:166 Identity:44/166 - (26%)
Similarity:68/166 - (40%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRTRFDKMNLGVPVH--------------SDPYE---VENESASSIKRETGEKVMSHKELMEKLH 51
            |..::|:||:....|              |.||.   .:.|...::....|...:...:|.:||.
Zfish    44 KSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHRMVGDEEDEGALSDSEGNTALPGDDLAQKLA 108

  Fly    52 KEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEF 116
            ..........|..:|...|.:.|:.|.  :.:|:||:..|...||:||.|...::|||:||..|.
Zfish   109 AAAAEGAESRFMQEPEEESSEEEEEEL--SPEEQARKKQFQMMRKMHYNEGMNIKLARQLIANEL 171

  Fly   117 TESSESQLSVDDEHISEIAEEE----CPPCGTDSDD 148
            .|..|.    :||.:.:..|.|    .||...||.|
Zfish   172 EEEDED----EDEEMKDDTETEDITVDPPQDADSLD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 24/92 (26%)
ppp1r2NP_991231.1 IPP-2 46..169 CDD:282789 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.