DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and SPAC17A5.09c

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_593477.1 Gene:SPAC17A5.09c / 2542189 PomBaseID:SPAC17A5.09c Length:310 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:46/247 - (18%)
Similarity:78/247 - (31%) Gaps:85/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ESSESQLSVDDEHISEIAEEECPPCGTDSDDLLPYFQYD-----RATDQS--------------- 162
            ||.:.|..|......::.|.:|...||.|::.:...::|     :|..|.               
pombe    23 ESGQQQNMVSSTPSIDMNESDCSGTGTPSEERIRRLRWDEENLSKAEQQKSAKMKITEPKTPFQR 87

  Fly   163 -MISDDSLP---------KED-----------PEPGFHPAHHCYNKLISQTPDPPIVYVPAEPEP 206
             ::.||.:|         |:|           ..|....:....:..:|.:.|....||..||.|
pombe    88 FLLPDDEVPEINLDETDSKDDFTAGTLGDTLGTLPSTRVSKDSKDDNVSFSSDKKQFYVKKEPFP 152

  Fly   207 QPEPQPEPPVE--------PRPEPEPE---PEPETVLP-PTAP--EVIDKTAPEEEKHTR----- 252
            .|..:|....:        |.|:...:   |..:.:.| .|.|  ||:.......:.|.|     
pombe   153 VPCTEPTTSGDRYTVRMKAPTPKYSTDNHLPSKKELFPRETKPQVEVVHARINNPDDHLRTHPSV 217

  Fly   253 ------------------VLDRGENIDLKNLSAIQKNISSSV-------KKH 279
                              :|...|.::.:.||..::||....       |||
pombe   218 NNLGKDSDHADKMYNEGVILGEDEAMEEEALSEAEENIPKKKPDFNELRKKH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789
SPAC17A5.09cNP_593477.1 IPP-2 58..>133 CDD:282789 9/74 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.