DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and ppp1r2

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001163967.1 Gene:ppp1r2 / 100038193 XenbaseID:XB-GENE-479701 Length:187 Species:Xenopus tropicalis


Alignment Length:151 Identity:47/151 - (31%)
Similarity:70/151 - (46%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRTRFDKMNLGVPVHSDPYEVE------NESASSIKRETG---EKVMSHKELMEKLHKEV---KL 56
            |..::|:||:....|  |.:.:      :|.::...|..|   |..||..|..|.|..:|   ||
 Frog    42 KSQKWDEMNILATYH--PSDKDYGLMKIDEPSTPYHRMIGDDDEGAMSDSESNEDLTADVLAEKL 104

  Fly    57 -----TTPDFFAHDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEF 116
                 |.|.|.|..   .|.|.|:.|..|  :||.:|..|..:||.||.|...::|||:||.:|.
 Frog   105 AAAEGTDPKFLAQS---ESSDEEEEELTE--EEREKRKEFEMKRKHHYNEGMNIKLARQLIAKEL 164

  Fly   117 T-ESSESQLSVDDEHISEIAE 136
            . |..|.:  .:||.:.:|.:
 Frog   165 AGEVDEDE--DEDEEMQDITD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 34/106 (32%)
ppp1r2NP_001163967.1 IPP-2 44..158 CDD:368219 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.