DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and jam2

DIOPT Version :10

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001072218.1 Gene:jam2 / 779665 XenbaseID:XB-GENE-493973 Length:295 Species:Xenopus tropicalis


Alignment Length:195 Identity:44/195 - (22%)
Similarity:77/195 - (39%) Gaps:41/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PATNCRYSLAYGALFILLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWY 67
            ||  |...|.|.|      .||.:....:.::.......:....:.:|.||:.|:.|....::|.
 Frog     4 PA--CAIFLGYFA------ALCCKETFGVYVSSDNSNVQVQEFGEIILSCKYKLEKEHPVRLEWK 60

  Fly    68 K---DG---FEFYRYVPRDMPPGQVFPLPGVDVELQNSTDVV---VVLRSVSLQSTGRYRCEVSG 123
            |   :|   |.:|...              :..:|:...:::   :.|::.:...:|:|||||: 
 Frog    61 KVVPNGDISFIYYNNT--------------LAADLRGRAEMIESSIWLKNATRADSGKYRCEVT- 110

  Fly   124 EAP----SFQTVSGHEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGM 184
             ||    |||.:.  .|:.|:|.|  |..:....|....|..|.:.|..:...|.....|..||:
 Frog   111 -APKDNKSFQEIV--IDLKVLVAP--GVPVCDVPPSAMSGTAVELKCRESEGFPASEYRWYKNGI 170

  Fly   185  184
             Frog   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIbNP_788071.3 None
jam2NP_001072218.1 Ig 26..128 CDD:472250 24/119 (20%)
Ig strand B 41..45 CDD:409353 1/3 (33%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 90..94 CDD:409353 0/3 (0%)
Ig strand F 104..109 CDD:409353 3/4 (75%)
Ig strand G 120..123 CDD:409353 0/4 (0%)
Ig 134..230 CDD:472250 8/37 (22%)
Ig strand B 148..152 CDD:409353 1/3 (33%)
Ig strand C 162..166 CDD:409353 0/3 (0%)
Ig strand E 194..198 CDD:409353
Ig strand F 208..213 CDD:409353
Ig strand G 223..226 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.