DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and beat-VII

DIOPT Version :9

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster


Alignment Length:477 Identity:90/477 - (18%)
Similarity:177/477 - (37%) Gaps:135/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYK-DGFEFYRYVPRDMPPGQVFPLPGVDVEL 96
            :..:.:|:::.|...|...|..::..|.|:.|.|.| |..:|:.::....||.:...:.|.:::.
  Fly    26 LVNLVVPRYVERGSSATFKCTHNVRPEILFKVTWLKVDKGKFFEFINGRNPPFRNSTIEGAEIDW 90

  Fly    97 QNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHEDMIVVVTPKHGPQITGGQPR--YQIG 159
            .||.:..|.|:.|....:|::.||||.:.|.| |.:..::::.|..|:.||.....:.|  :.:|
  Fly    91 DNSNEQQVTLKDVQFDLSGQFYCEVSTDTPIF-TKASADELMSVFLPQTGPPTIKFRKRTPFAVG 154

  Fly   160 DMVRVNCTSAASRPVCHLSWLI------------------NGMHANRSLLRPYEPLIVGREGLEV 206
            :.:...|.:...||..|::|||                  ||.|.::...:..:...:.::.|:.
  Fly   155 EKLFALCNTTRGRPAPHITWLINGKKVEDRYVRTHHVFSFNGKHQHQRRTQQQQQTQLSQQQLQQ 219

  Fly   207 -----------------------------------ARLG-----LEFRVRGXHFKHGDMKLKCVA 231
                                               ||..     |.....| |..||.:......
  Fly   220 QYFQQQYFNQYHQQYHIPVGQFMDRYDKSLRWPAGARADEFPHFLSHHHEG-HGHHGSLYNNPFG 283

  Fly   232 KISSVY------------WQSNEESVESDKHQRIPVLESR-----------ETVMSKSRQSMD-- 271
            .:::.:            :.||::::|..|.|::.:.:.|           |..:...|.:::  
  Fly   284 SLANYHDVGEFHEVHQRNYDSNKKNMELKKQQQMEMKKHRNSNRKYRRHINENALGIIRSTLNSG 348

  Fly   272 ----KAQLEDKQL-------------KKSRRPAAATSAAAAAAAAAASSSASRATVAPFGAMWGS 319
                :|...:|:|             ...:||.:.....:..|||||:.:|::.....|      
  Fly   349 GFGPQAPNMNKELGIPSNAGPMNQLAAGYQRPLSHPGGGSGVAAAAAAVTAAQQEKGMF------ 407

  Fly   320 SVPWSRILASK----SIARISLYALPVLIAFLCSFRPAVGQG------------CSCRRSNGSRG 368
            |:....|..::    |.:|:.:..|..:.|       .||||            ....|...|..
  Fly   408 SISQLNIELTEEHVGSNSRMEITCLSTIPA-------TVGQGEQYADYKTYSVKVEVERQLASST 465

  Fly   369 SSTSSNINSSNMGN-SSHINRS 389
            |:.|.:|..:.:|| :.|.|.:
  Fly   466 STASPSIGMAALGNGNGHGNET 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIbNP_788071.3 None
beat-VIINP_733162.2 Ig 31..118 CDD:299845 24/86 (28%)
IG_like 34..118 CDD:214653 23/83 (28%)
Ig 141..>183 CDD:299845 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.