DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and beat-Va

DIOPT Version :9

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster


Alignment Length:312 Identity:87/312 - (27%)
Similarity:138/312 - (44%) Gaps:39/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YGALFILLLQLC--FESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYKDGFEFYR 75
            ||.|..|.:.|.  :.....|.:|:|.:|:.:...::..|.|.:|:.|.:|.|||||||..||:|
  Fly     3 YGWLMFLFIALLIDYPIAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFR 67

  Fly    76 YVPRDMPPGQVFPLPGVDV----ELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHED 136
            |.|...|....|.:.|:.|    .:.|.:...:.|.....:|||.|:|||||:||.|:.....::
  Fly    68 YSPLTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGDAPHFKLADKADN 132

  Fly   137 MIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANRSLLRPYEP----- 196
            |.|...|::.|.|......|::.:.::..|.|..|.....|:|.|||   .:.||....|     
  Fly   133 MTVAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYING---EQPLLGELYPTTDTS 194

  Fly   197 LIVGREGLEVARLGLEFRVRGXHFKHGD--MKLKCVAKISSVYWQSNEESVESDKHQRIPVLESR 259
            |......|...||.::|.::| .|....  ::|||||:|                 :..|.|...
  Fly   195 LAAHDYVLRRQRLQVQFFLQGQRFFQAGKILELKCVAEI-----------------ENYPELRRE 242

  Fly   260 ETVMSKSRQSMDKAQLEDKQLKKSRRPAAATSAAAAAAAAAASSSASRATVA 311
            :|:      |...:|.::...:...|.|.|.|.:|..:.....:|...|.:|
  Fly   243 KTL------SASLSQYDNFNNQMPLRHANANSGSAQRSILCGRTSLISAFLA 288



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.