DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and CG5597

DIOPT Version :9

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:209 Identity:46/209 - (22%)
Similarity:94/209 - (44%) Gaps:37/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLAYGALFILLLQ---LCFESVECLTMTEIKIPKHIMRHED---AVLGCKFDL-DGESLYSVKWY 67
            :|....|.|.||.   ||:.:.:   .:|.||  .::::|:   .:|.|.::: :.....:||||
  Fly     3 TLLIAILAIGLLHRDALCYPTRD---ESEDKI--IVLQNEEMEPTILDCDYEVEESPKFITVKWY 62

  Fly    68 KDGFEFYRYVPRDMPPGQVFPLP----GVDVELQNSTD-----VVVVLRSVSLQSTGRYRCEVSG 123
            :|....|::: ...||   :.:|    .:|...::||:     ..:.|.:.::.:||.|:|.|. 
  Fly    63 RDDKSIYQWI-FGTPP---YAIPEFRNEIDSTYESSTEPSKQYSSLALINPTIATTGDYKCVVQ- 122

  Fly   124 EAPSFQTVSGHEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANR 188
              .|..|.|.|:.:.|:....:..:::    ...|.:..::|||.....|...::.:.|.|...:
  Fly   123 --TSLNTFSSHQRVQVIDLRNYTLELS----HKTIHNETQLNCTVTNVYPRPTITIISNDMDVVK 181

  Fly   189 SLLRPYEPLIVGRE 202
            .     ||::...|
  Fly   182 R-----EPMVYENE 190



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.