DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and CG13532

DIOPT Version :10

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster


Alignment Length:135 Identity:26/135 - (19%)
Similarity:56/135 - (41%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLQLCFESV-ECLTMTEIKIPKHIMRHED-----AVLGCKFDL-DGESLYSVKWYKDGFEFYRY 76
            ||..|...|| ..:.:|.:::|:......|     .||.|:.:: ..|..:.:||..:....|::
  Fly    13 LLAVLALLSVTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFNNHSIYQW 77

  Fly    77 VPRDMPPGQVFPLPGVDVEL--QNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHEDMIV 139
            :|........|....:|.::  ...:..|:.:::.....||.|.|.|.    :|::.......:.
  Fly    78 IPSVKGFAMGFMKSKIDTKIFTMEGSPGVISIKNPDWNMTGEYTCAVQ----TFESTDKRSARLQ 138

  Fly   140 VVTPK 144
            ::.|:
  Fly   139 IIVPE 143

Return to query results.
Submit another query.