DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and beat-IIIc

DIOPT Version :9

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster


Alignment Length:273 Identity:151/273 - (55%)
Similarity:201/273 - (73%) Gaps:8/273 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYKDGFEFYRYVPRDMPPGQVFPLPGVDVE 95
            |.:||::||.::::...|.|.|.:|||||:||||||||||.||||||||||||.|.|.||||:|:
  Fly    25 LRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRYVPRDMPPAQTFLLPGVNVD 89

  Fly    96 LQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHEDMIVVVTPKHG-PQITGGQPRYQIG 159
            |.||:|.:|.||:|:|||.||:||||||||||||||:.|.||||...|..| |:|:||:||||||
  Fly    90 LHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPRYQIG 154

  Fly   160 DMVRVNCTSAASRPVCHLSWLINGMHANRSLLRPYEPLIVGREGLEVARLGLEFRVRGXHFKHGD 224
            |.||||||:..|:|...|||.:||....:..||.|:.::.||:|||.:.|||:|||.. ||:.|:
  Fly   155 DYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVSGRDGLETSVLGLQFRVEQKHFRKGN 219

  Fly   225 MKLKCVAKISSVYWQSNEESVESDKHQRIPVLESRETVMSKSRQSMDKAQLEDKQLKKSR----- 284
            |||||:|::|:|||:.||||||.|:.|:.|||||||||.:.:.::........::|..::     
  Fly   220 MKLKCIAELSTVYWRCNEESVEGDRPQKAPVLESRETVYASNSRADPVQGTSYRELFVTKILSLL 284

  Fly   285 --RPAAATSAAAA 295
              :|.||:|.|:|
  Fly   285 FVQPNAASSTASA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIbNP_788071.3 None
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 65/93 (70%)
Ig 42..127 CDD:143165 64/84 (76%)
Ig 140..219 CDD:299845 41/78 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MP4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108442at50557
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.