DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and beat-Ic

DIOPT Version :9

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster


Alignment Length:414 Identity:120/414 - (28%)
Similarity:194/414 - (46%) Gaps:56/414 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ILLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYKDGFEFYRYVPRDMP 82
            :|||.|..:.:|.|....:.||:.:.|..:|:..|.:|::.::||||||||...|||||.|::.|
  Fly    44 VLLLILVPDFIEALKDVSVMIPQAVKRGSNALFTCNYDMENDTLYSVKWYKGKREFYRYTPKENP 108

  Fly    83 PGQVFPL-PGVDVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHEDMIVVVTPKHG 146
            ..:||.: .|::||...|....|||:||.|..:|::.||:|.|||:|||.....:|.||..|:..
  Fly   109 AMKVFAMTSGLNVERNLSNQSHVVLQSVPLNISGKFTCEISVEAPTFQTAMVSGEMEVVELPEEH 173

  Fly   147 PQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANRSLLRPYEPLIVGREGLEVARLGL 211
            ..:||.|.||:|||:|..||:...|:|..:|:|.|||:......::.|:........||.....:
  Fly   174 TVVTGIQARYRIGDLVDGNCSIKYSKPAANLTWTINGIVVPPHHIKTYQTEKRENSTLESVTSAI 238

  Fly   212 EFRVRGXHFKHGDMKLKCVAKISSVYWQSNEESVESDKHQRIPVLESRETVMSKSRQ-------- 268
            .|.|.. ||..|.|:|||.|.|..::.:..|..:|.|          |..:|:..|.        
  Fly   239 HFMVTNQHFLKGQMRLKCTANIFDIFKEEMESVIEED----------RPRIMASGRSYDINNYPL 293

  Fly   269 ----SMDKAQLEDKQLKKSRRPAAATSAAAAAAAAAASSSASRATVAPFGAMWGSSV-------- 321
                :.::...||      ...:..|..:|...|:.||::|...    |...|.|.:        
  Fly   294 EEHTNGERGGFED------HNESYLTYYSADNTASGASTAAHEI----FWQFWPSQLTKLPINRQ 348

  Fly   322 ---PWSRILASKSIARISLYAL----PVLIAFL-CSF-RPAVGQGCSCRRSNGSRGSSTSSNINS 377
               .|..:......|.:.|:.|    |:....: |.: :||.|:   .::...:.|||::..:.:
  Fly   349 LAGAWHWLCGGGGAAALLLFFLLQQGPLGHQIINCQYTKPATGK---VQQQQRNSGSSSNIEVTA 410

  Fly   378 SNMGNSSHINRSRLSSQLSCEKAV 401
            |....||   .|.:....:|:.|:
  Fly   411 SKAATSS---ASSVKCFYNCQMAM 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIbNP_788071.3 None
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.