DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and f11r.2

DIOPT Version :9

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001076451.1 Gene:f11r.2 / 100005566 ZFINID:ZDB-GENE-060531-67 Length:294 Species:Danio rerio


Alignment Length:263 Identity:56/263 - (21%)
Similarity:96/263 - (36%) Gaps:71/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IMRHEDAVLGCKFDLDGESLYSVKW-YKD--GFEFYRYVPRDMPPGQVFPLPGVDVELQNSTDVV 103
            :..:|...|.|.:..|..:...|:| :::  ||:::.|....         |.|:.| |..|...
Zfish    31 VKENEGVDLQCSYTADFGATPRVEWKFRNLKGFQYFIYFNNK---------PTVEYE-QRITVYA 85

  Fly   104 VVLR--SVSLQSTGRYRCEVSGEAPSFQTVSGHED---MIVVVTPKHGPQITGGQPRYQIGDMVR 163
            ..||  .|:....|.|.|||||.       .|:.:   .:||..|...| ::........|..||
Zfish    86 GGLRFQKVTRADAGDYNCEVSGN-------GGYGENTIKLVVSVPPSKP-VSSIPSSVTTGSNVR 142

  Fly   164 VNCTSAASRPVCHLSWLINGMHANRSLLRPYEPLIVGREGLEVARLGLEFRV-RGXHFK----HG 223
            :.|......|.....|     :.:.:|| |.:|              .:|.: :. .:|    :|
Zfish   143 LTCFDPVGSPPSTYEW-----YKDNNLL-PEDP--------------TKFPIFKNLTYKMNAFNG 187

  Fly   224 DMKLKCVAKISSVYWQ--------SNEESVESDKH-----QRIPVLESRETVMSKSRQSMDKAQL 275
            :::...|:|     |.        |||..|  .:|     ..:..::|.:.:..||..||:...:
Zfish   188 NLEFLSVSK-----WDAGSYFCVASNENGV--SQHGDAVKMEVYDVDSSQVLDVKSNLSMETHNI 245

  Fly   276 EDK 278
            ..|
Zfish   246 PGK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIbNP_788071.3 None
f11r.2NP_001076451.1 Ig 29..120 CDD:299845 25/105 (24%)
IG_like 29..120 CDD:214653 25/105 (24%)
Ig_2 132..212 CDD:290606 19/104 (18%)
IG_like 134..216 CDD:214653 20/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.