DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIb and jam2b

DIOPT Version :9

Sequence 1:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001121766.1 Gene:jam2b / 100005301 ZFINID:ZDB-GENE-080229-3 Length:306 Species:Danio rerio


Alignment Length:226 Identity:53/226 - (23%)
Similarity:84/226 - (37%) Gaps:53/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYKDGFEF-YRYVPRDMP 82
            |||.:...|.:.:|:|..|....:..:.:|||.|:|..:.|:...|:|.|.|.:. |.|...|. 
Zfish    21 LLLLIYIPSSDPVTVTTSKAKMDVHENTNAVLSCEFRTEKETNPRVEWKKRGKDVSYVYFEGDF- 84

  Fly    83 PGQVFPLPGVDVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQ------TVSGHEDMIVVV 141
            .|.......:|       ...:.||.|:.:.:|.|.|||:......:      |:|       |:
Zfish    85 TGSYKGRASID-------GATLTLRGVTQKDSGVYHCEVTARQDKIKLGEVSVTLS-------VL 135

  Fly   142 TPKHGPQITGGQPRYQI-GDMVRVNCTSAASRPVCHLSWLINGMHANRSLLRPYEPLIVGREGLE 205
            .|.|.|  |...|...: |....::|....|.|....||..:....|.:  .|::          
Zfish   136 VPPHAP--TCEVPEAVMRGFSAELHCKDKLSVPAATYSWYKDNKPLNTA--NPHD---------- 186

  Fly   206 VARLGLEFRVRGXHF----KHGDMKLKCVAK 232
                         |:    |.|.:|.|.|:|
Zfish   187 ------------VHYTLDTKTGSLKFKSVSK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIbNP_788071.3 None
jam2bNP_001121766.1 Ig 44..135 CDD:299845 25/105 (24%)
IG_like 44..134 CDD:214653 25/104 (24%)
IGc2 154..220 CDD:197706 14/76 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.