DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ApepP and XPNPEP3

DIOPT Version :9

Sequence 1:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_071381.1 Gene:XPNPEP3 / 63929 HGNCID:28052 Length:507 Species:Homo sapiens


Alignment Length:317 Identity:85/317 - (26%)
Similarity:122/317 - (38%) Gaps:104/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 WIAPT-----SSYY--LTALIPKS----RRIQEVTPICVLKAIKNDVE-----IAGFINSHIRDG 330
            |:.|:     |.|.  ||....||    |.:|::  |..|:.||:..|     |||.:.|.    
Human   206 WMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQL--IQRLRLIKSPAEIERMQIAGKLTSQ---- 264

  Fly   331 VALCQYFAWLEDQVNKGAEVDE------------MSGADKLESFRSTKDKYMGLSFTTISASGPN 383
                   |::|......|.|:|            ..|||.             |::..:.|.|..
Human   265 -------AFIETMFTSKAPVEEAFLYAKFEFECRARGADI-------------LAYPPVVAGGNR 309

  Fly   384 GSVIHYHPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEPTEFQKEAYTRVLKGQLSF 447
            .:.:||   .:.|:.|.|.|:.|.|.|.:.....:|:|||... |..|..|.|.|..||:.|...
Human   310 SNTLHY---VKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDC 371

  Fly   448 GSTVFPAKVKGQVLD-------TLARKALWDVGL--------------DYGHGTGHGVGHFL--N 489
            .:..||    |..|:       ||..:.|.|:|:              .|   ..|.|||:|  :
Human   372 LALCFP----GTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKY---CPHHVGHYLGMD 429

  Fly   490 VHEGPMGVGIRLMPDDPGLQANMFISNEPGFY--QDGE--------FGIRVEDIVQI 536
            ||:.|.      ||....||..|.|:.|||.|  :|.:        .|:|:||.|.:
Human   430 VHDTPD------MPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVV 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430 14/46 (30%)
APP 321..545 CDD:238518 68/262 (26%)
Peptidase_M24_C 551..613 CDD:318429
XPNPEP3NP_071381.1 Interaction with TNFRSF1B. /evidence=ECO:0000269|PubMed:25609706 54..79
PRK10879 67..506 CDD:182804 85/317 (27%)
AMP_N 72..205 CDD:282980
Prolidase 252..490 CDD:238520 70/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.