DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ApepP and PEPD

DIOPT Version :9

Sequence 1:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_000276.2 Gene:PEPD / 5184 HGNCID:8840 Length:493 Species:Homo sapiens


Alignment Length:449 Identity:96/449 - (21%)
Similarity:164/449 - (36%) Gaps:154/449 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 RQQLKEKNA--DALVVSALDEIA---------WFLNLRGSDIDFNPVFFSYLIVTNDELLLF-VD 239
            ::..|||.|  |   |..:||||         ..|.|||.:.|...|...   .:.|.:..| |:
Human   114 KEHFKEKYAVDD---VQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCRE---ASFDGISKFEVN 172

  Fly   240 SGKLPTDFVQHQK-ENNVQISVLPYASIGIEISKIVSTRESKIWIAPTSSYYLTALIPKSRRIQE 303
            :..|..:.|:.:. :.::::.||.|.      :||.|....:                       
Human   173 NTILHPEIVECRVFKTDMELEVLRYT------NKISSEAHRE----------------------- 208

  Fly   304 VTPICVLKAIKNDVEIAGFINSHIRDGVALCQYFAWLEDQVNKGAEVDEMSGADKLESFRSTKDK 368
                 |:||:|                |.:.:|            |::.:     .|.:..::..
Human   209 -----VMKAVK----------------VGMKEY------------ELESL-----FEHYCYSRGG 235

  Fly   369 YMGLSFTTISASGPNGSVIHY-HPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEPTE 431
            ....|:|.|..||.|.:|:|| |.....:|.|.:.::.|.|.|.:|....:|:|.:... |:.|.
Human   236 MRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTA 300

  Fly   432 FQKEAYTRVLKGQLSFGSTVFPA-------KVKGQV-LDTLARKALWDVGLD---YGH-GT---G 481
            .||..|..||:...:....:.|.       ::..:: |:.||...:....:|   ..| |.   .
Human   301 DQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMP 365

  Fly   482 HGVGHFL--NVHE-GPMGVGIRLMPDDPG---------LQANMFISNEPGFY----------QD- 523
            ||:||||  :||: |....|:..: |:||         ||..|.::.|||.|          .| 
Human   366 HGLGHFLGIDVHDVGGYPEGVERI-DEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADP 429

  Fly   524 ---------------GEFGIRVEDIVQIVPGQVAHNFSNRGALTFKTITMCPKQTKMIK 567
                           |..|:|:|:.|.:....:            :.:|..|:..:.|:
Human   430 ARASFLNREVLQRFRGFGGVRIEEDVVVTDSGI------------ELLTCVPRTVEEIE 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430 31/143 (22%)
APP 321..545 CDD:238518 62/278 (22%)
Peptidase_M24_C 551..613 CDD:318429 3/17 (18%)
PEPDNP_000276.2 AMP_N 18..155 CDD:198079 15/43 (35%)
Prolidase 192..467 CDD:238520 72/354 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.