DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ApepP and CG5188

DIOPT Version :9

Sequence 1:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster


Alignment Length:235 Identity:50/235 - (21%)
Similarity:80/235 - (34%) Gaps:60/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 QVNKGAEVDEM--SG---------ADKLESFRSTKDKYMGLSFTTISASGPNGSVIHY--HPKK- 393
            ::....::|.|  ||         ..||.:..:|.|:....:...|..|....|.:.|  .||. 
  Fly    72 EIKSQVQIDAMRLSGRLAARILRECGKLATVGTTTDQIDAFAHERILESKAYPSPLRYAGFPKSI 136

  Fly   394 ------------ETNRKINDKEIYLCDSGAQYLDG-TTDVTRTLHFGEPTE---FQKEAYTRVLK 442
                        ..:|::.|.:|...|. ..:|:| ..|.:.|...|...|   |..||....|.
  Fly   137 CTSINNIACHGIPDDRQLADGDIINIDV-TVFLNGYHGDCSETFRVGNVDERGGFLVEATKSCLD 200

  Fly   443 GQLSFGSTVFPAKVKGQVLD------TLARKALWDVGLDYGHGTGHGVGHFLNVHEGPMGVGIRL 501
            ..:|...........|:.:|      .||..|.:         .|||:|.:.:   ||..: :..
  Fly   201 QCISLCGPGVEFNEIGKFIDRYCDEHDLASIAAF---------IGHGIGSYFH---GPPEI-LHY 252

  Fly   502 MPDDPG-LQANMFISNEP---------GFYQDGEFGIRVE 531
            ..:.|| :|..|..:.||         ...|||...|.::
  Fly   253 YNEIPGKMQPGMTFTIEPILSLGGAEIAVLQDGWTAISLD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430
APP 321..545 CDD:238518 50/235 (21%)
Peptidase_M24_C 551..613 CDD:318429
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 50/228 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.