DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ApepP and und

DIOPT Version :9

Sequence 1:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster


Alignment Length:442 Identity:73/442 - (16%)
Similarity:126/442 - (28%) Gaps:204/442 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 PTSSYYLTALIPKSRRIQEVTPICV-----------------LKAIKNDV------------EIA 320
            |.:..|.....|:...::..||..:                 |..|..|:            :..
  Fly    86 PIAKLYPDGNFPEGEIVEHPTPKDMPDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEAHRQTR 150

  Fly   321 GFINSHIRDGVALCQYFAWLEDQVNKGAEVDEMSGADKLESFRSTKDKYMGLSFTTISASGPNGS 385
            .::..:|:.|:.:.|....||:...:      :.|.:.||:         ||:|.|  ....|..
  Fly   151 QYMQRYIKPGMTMIQICEELENTARR------LIGENGLEA---------GLAFPT--GCSLNHC 198

  Fly   386 VIHYHPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHFGEPTEFQKEAYTRVLKGQLSFGST 450
            ..||.|                                 :.|:||..|   |..|.|  :.||: 
  Fly   199 AAHYTP---------------------------------NAGDPTVLQ---YDDVCK--IDFGT- 224

  Fly   451 VFPAKVKGQVLD-----------------------TLARKALWDVGL-DYGHG------------ 479
                .:||:::|                       |..|:|..||.| |.|..            
  Fly   225 ----HIKGRIIDCAFTLTFNNKYDKLLQAVKEATNTGIREAGIDVRLCDIGAAIQEVMESYEIEL 285

  Fly   480 -------------TGHGVGHFLNVHEGPMGVGIRLMPDDPGLQANMFISNEPGFYQDGEFG---- 527
                         .||.:..: .:|.|      :.:|...|.::.....:|  ||....||    
  Fly   286 DGKTYPIKAIRNLNGHSISPY-RIHAG------KTVPIVKGGESTRMEEDE--FYAIETFGSTGR 341

  Fly   528 ----------------------IRVEDIVQIVPGQVAHNFSNRGALTFKTITMCPK--------Q 562
                                  :|::...|:: |.:..||.        |:..|.:        :
  Fly   342 GLVHDDMDCSHYMKNFDLPFVPLRLQSSKQLL-GTINKNFG--------TLAFCKRWLDRAGATK 397

  Fly   563 TKMIKKEL-----------LSDAEVKLLNSYHQQVW--DTLSPILSREGDEF 601
            .:|..|:|           |.|.:......|...:.  .|...::|| ||::
  Fly   398 YQMALKDLCDKGIVEAYPPLCDIKGCYTAQYEHTIMLRPTCKEVVSR-GDDY 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430 8/61 (13%)
APP 321..545 CDD:238518 50/298 (17%)
Peptidase_M24_C 551..613 CDD:318429 13/72 (18%)
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 73/440 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.