DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ApepP and Xpnpep3

DIOPT Version :9

Sequence 1:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001334004.1 Gene:Xpnpep3 / 321003 MGIID:2445217 Length:506 Species:Mus musculus


Alignment Length:312 Identity:76/312 - (24%)
Similarity:119/312 - (38%) Gaps:95/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 WIAPT----SSYYLTALIP-------KSRRIQEVTPICVLKAIKND-----VEIAGFINSHIRDG 330
            |:.|:    .|.|:..|..       |.|.:|::  |..|:.:|:.     ::|||.:.|.    
Mouse   206 WMKPSHAQLHSDYMQPLTEAKARSKNKVRSVQQL--IQRLRLVKSPSEIKRMQIAGKLTSE---- 264

  Fly   331 VALCQYFAWLEDQVNKGAEVDE------------MSGADKLESFRSTKDKYMGLSFTTISASGPN 383
                   |::|......|.:||            ..|||.             |::..:.|.|..
Mouse   265 -------AFIETMFASKAPIDEAFLYAKFEFECRARGADI-------------LAYPPVVAGGNR 309

  Fly   384 GSVIHYHPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEPTEFQKEAYTRVLKGQ--- 444
            .:.:||   .:.|:.|.|.|:.|.|.|.:.....:|:|||... |..|..|.|.|..||:.|   
Mouse   310 SNTLHY---VKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRAC 371

  Fly   445 -------------LSFGSTVFPAKVKGQVLDTLARKALWDVGLDYGHGTGHGVGHFL--NVHEGP 494
                         .|...|:...|:|...:...::::.:.....|   ..|.|||:|  :||:.|
Mouse   372 LTLCSPGTSLENIYSMMLTLIGQKLKDLGITKTSKESAFKAARKY---CPHHVGHYLGMDVHDTP 433

  Fly   495 MGVGIRLMPDDPGLQANMFISNEPGFY--QDGE--------FGIRVEDIVQI 536
            .      ||....||..|.|:.|||.|  :|..        .|:|:||.|.:
Mouse   434 D------MPRSLPLQPGMVITVEPGIYIPEDDRDAPEKFRGLGVRIEDDVVV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430 11/51 (22%)
APP 321..545 CDD:238518 63/257 (25%)
Peptidase_M24_C 551..613 CDD:318429
Xpnpep3NP_001334004.1 Interaction with TNFRSF1B. /evidence=ECO:0000250|UniProtKB:Q9NQH7 54..79
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.