DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ApepP and Pepd

DIOPT Version :9

Sequence 1:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_032846.2 Gene:Pepd / 18624 MGIID:97542 Length:493 Species:Mus musculus


Alignment Length:242 Identity:69/242 - (28%)
Similarity:104/242 - (42%) Gaps:52/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 SFTTISASGPNGSVIHY-HPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEPTEFQKE 435
            |:|.|..||.|.:|:|| |.....:|.|.|.:|.|.|.|.:|....:|:|.:... |:.||.||.
Mouse   240 SYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGEYYCFASDITCSFPANGKFTEDQKA 304

  Fly   436 AYTRVLKGQLSFGSTVFPA-------KVKGQV-LDTLARKALW----DVGLDYGHGT---GHGVG 485
            .|..||:...:..||:.|.       ::..:: |:.|||..|.    |..|....|.   .||:|
Mouse   305 IYEAVLRSCRTVMSTMKPGVWWPDMHRLADRIHLEELARIGLLSGSVDAMLQVHLGAVFMPHGLG 369

  Fly   486 HF--LNVHE-GPMGVGIRLMPDDPGLQA---------NMFISNEPGFYQDGEFGIRVEDIVQIVP 538
            ||  |:||: |....|:..: |:|||::         .|.::.|||.|    |...:.|.....|
Mouse   370 HFLGLDVHDVGGYPEGVERI-DEPGLRSLRTARHLEPGMVLTVEPGIY----FIDHLLDQALADP 429

  Fly   539 GQ-------VAHNFSNRGALT-----------FKTITMCPKQTKMIK 567
            .|       |...|.|.|.:.           .:.:|..|:..:.|:
Mouse   430 AQACFFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTCVPRTVEEIE
 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430
APP 321..545 CDD:238518 63/207 (30%)
Peptidase_M24_C 551..613 CDD:318429 3/28 (11%)
PepdNP_032846.2 AMP_N 23..138 CDD:282980
PepP 52..476 CDD:223085 68/240 (28%)
Prolidase 192..467 CDD:238520 66/231 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.