Sequence 1: | NP_001246053.1 | Gene: | ApepP / 35029 | FlyBaseID: | FBgn0026150 | Length: | 613 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032846.2 | Gene: | Pepd / 18624 | MGIID: | 97542 | Length: | 493 | Species: | Mus musculus |
Alignment Length: | 242 | Identity: | 69/242 - (28%) |
---|---|---|---|
Similarity: | 104/242 - (42%) | Gaps: | 52/242 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 373 SFTTISASGPNGSVIHY-HPKKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHF-GEPTEFQKE 435
Fly 436 AYTRVLKGQLSFGSTVFPA-------KVKGQV-LDTLARKALW----DVGLDYGHGT---GHGVG 485
Fly 486 HF--LNVHE-GPMGVGIRLMPDDPGLQA---------NMFISNEPGFYQDGEFGIRVEDIVQIVP 538
Fly 539 GQ-------VAHNFSNRGALT-----------FKTITMCPKQTKMIK 567 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ApepP | NP_001246053.1 | Creatinase_N | 9..154 | CDD:307473 | |
Creatinase_N_2 | 158..318 | CDD:318430 | |||
APP | 321..545 | CDD:238518 | 63/207 (30%) | ||
Peptidase_M24_C | 551..613 | CDD:318429 | 3/28 (11%) | ||
Pepd | NP_032846.2 | AMP_N | 23..138 | CDD:282980 | |
PepP | 52..476 | CDD:223085 | 68/240 (28%) | ||
Prolidase | 192..467 | CDD:238520 | 66/231 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0006 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |