DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and HNRNPDL

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens


Alignment Length:293 Identity:63/293 - (21%)
Similarity:111/293 - (37%) Gaps:64/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 AKANAN-NKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRT---AGGK 192
            :|.||: |:.::|            .:|:|.|..:|.:..|.:....:|.|....::|   .|..
Human   136 SKINASKNQQDDG------------KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRS 188

  Fly   193 QLFKHKQRKVAGSLNAYVVLEKPEI------AQQALALNGSEFKENHLRVTPASMAEKFGQAKDK 251
            :.|.....|.|.|::..:.|::.::      .::|.||.|                        |
Human   189 RGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKG------------------------K 229

  Fly   252 QPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGL 315
            :|..|     :|||.|....:|||::|.|.:.|||:.|....|.... .:|..::.:...:.|..
Human   230 EPPKK-----VFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKK 289

  Fly   316 ALELNQTLLDDRPINVERYQVKKLGAKQVRD-----AAAASAASKTSSKTKAKNQN-SAGAKKRL 374
            .||.....:......::..|.|::..:|.:.     .|||.....|..:.:.:.|| :.|.....
Human   290 LLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYY 354

  Fly   375 DKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDG 407
            |:..|..|      .|..|.:..|.|.|....|
Human   355 DQGYGNYN------SAYGGDQNYSGYGGYDYTG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 18/90 (20%)
RRM_SF 261..332 CDD:302621 18/71 (25%)
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120
RRM1_hnRPDL 149..224 CDD:410152 14/74 (19%)
RRM2_hnRPDL 234..308 CDD:409998 19/78 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348 7/34 (21%)
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420 12/46 (26%)
Necessary for its nuclear import and export 396..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.