DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and HNRNPDL

DIOPT Version :10

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens


Alignment Length:41 Identity:14/41 - (34%)
Similarity:18/41 - (43%) Gaps:11/41 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEYRLPLEF-IQKKVLHVTIWSHDSLQENAFLGGIELPLAE 43
            |.|.||..| |.||.|  ::.:.:.|        |..||.|
Human   917 LRYFLPPSFPISKKEL--SVMNSEEL--------ISFPLKE 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828
RRM_SF 261..332 CDD:473069
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120
RRM1_hnRPDL 149..224 CDD:410152
RRM2_hnRPDL 234..308 CDD:409998
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420
Necessary for its nuclear import and export 396..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.