DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and SRSF9

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens


Alignment Length:235 Identity:52/235 - (22%)
Similarity:92/235 - (39%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAG 204
            ||.|       .|....::|||||.:.:...|..||..||.::.|.|:...|...|         
Human     6 DERG-------GEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPF--------- 54

  Fly   205 SLNAYVVLEKPEIAQQAL-ALNGSEFKENHLRVT-PASMAEKFGQAKDKQ--PSDKDAKRTIFVG 265
               |:|..|.|..|:.|: ..||.::.:..|||. |.:...:.|..:..:  |..:.:...:.|.
Human    55 ---AFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVS 116

  Fly   266 SLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPIN 330
            .|..|.:.:.|::.....|::.|....:|      ||..|.:.:.:.:..||.    .|||....
Human   117 GLPPSGSWQDLKDHMREAGDVCYADVQKD------GVGMVEYLRKEDMEYALR----KLDDTKFR 171

  Fly   331 VERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGA 370
            ....:...:.....|..:...:.|::.|:.:.....|.|:
Human   172 SHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/82 (29%)
RRM_SF 261..332 CDD:302621 15/70 (21%)
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 25/82 (30%)
RRM2_SRSF9 104..186 CDD:410161 16/91 (18%)
Interaction with SAFB1 188..200 1/11 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.