DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and HRB1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_014394.2 Gene:HRB1 / 855728 SGDID:S000004949 Length:454 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:63/297 - (21%)
Similarity:105/297 - (35%) Gaps:75/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGS 205
            ||.|.|     ..::::|||||..::....|.:.|...|.|....:.|:.|    .|:      .
Yeast   152 EEKVNR-----NYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRG----HHR------G 201

  Fly   206 LNAYVVLEKPEIAQQALALNGSEFKENHLRV----TPASMAEKFGQAKDKQPSDKDAK-RTIFVG 265
            :.........::.:.....:|:.|.:..:.|    .|.|...|..:|.|:.....:.| ..:.|.
Yeast   202 MGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVK 266

  Fly   266 SLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCF----------QKPDAVGLALELN 320
            :|..|...:.|::||..||.:.:.....|||....|...|.|          :|.:  |.::|.|
Yeast   267 NLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYN--GYSIEGN 329

  Fly   321 -------------------QTLLDDRPINVE--RYQVKKLGAKQVRDAAAASAASKTSSK----- 359
                               ...:||.|:|.|  ::....:|..:.......|....:::|     
Yeast   330 VLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGERNRLIYCSNLPFSTAKSDLYD 394

  Fly   360 ---TKAKNQNSAGAKKRLDKKKGKENGSLKKEGAPTG 393
               |..|..|   |:.|.|.|           |||||
Yeast   395 LFETIGKVNN---AELRYDSK-----------GAPTG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 15/85 (18%)
RRM_SF 261..332 CDD:302621 22/99 (22%)
HRB1NP_014394.2 PRK12678 <29..>85 CDD:237171
RRM1_HRB1_GBP2 160..236 CDD:410184 15/85 (18%)
RRM2_HRB1_GBP2 262..334 CDD:410185 18/73 (25%)
RRM3_HRB1_GBP2 374..452 CDD:410186 14/58 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.