DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and NOP13

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_014224.2 Gene:NOP13 / 855547 SGDID:S000005119 Length:403 Species:Saccharomyces cerevisiae


Alignment Length:450 Identity:110/450 - (24%)
Similarity:178/450 - (39%) Gaps:104/450 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SKTKPKKKTVKVPKD---EVKAAVQESPKKLSAKDLAKIEKKK----AKKQAQKLKK-------- 82
            |:|:..|:.....||   :||.|:.:..||..|:|..:|:.|.    :|||.:.|::        
Yeast     2 SETELSKEDAVTKKDNEEQVKKALLDPTKKRKAEDEIEIDLKSSIPLSKKQKRLLRRGKVTLEEL 66

  Fly    83 -QQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPT-TAPNEKPKGKVSKKAKANANNKDEEGVK 145
             .:..:.||.|:...|...|.:|.|::|:...:|.| ..|.....|:|.||.|.:.|...     
Yeast    67 NAKYNIDPKSIEEYKEDAEKKKSGASEKDAQGEESTINTPTGDESGEVVKKKKKDENKYG----- 126

  Fly   146 RIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYV 210
                       |::|||..:|.:..||:.|            .|..|.....|.|.....:..  
Yeast   127 -----------VWIGNLSFDTTKDDLVRFF------------IAKTKDNEDEKSRVTEQDITR-- 166

  Fly   211 VLEKPEIA---QQALALNG---------------SEFKENHL--RVTPASMAEKFGQAKDKQP-- 253
             |..|.:|   ..|:...|               .|..|:||  |......:|.:....||..  
Yeast   167 -LSMPRVAAKNSNAMKNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLV 230

  Fly   254 --SDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGL 315
              |.....|.:|||:|.:..|::.||:.|..||:|..||.....|.| |||.|::.|:..:....
Yeast   231 AMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTN 295

  Fly   316 AL-ELNQTLLDDRPINVE------RYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKR 373
            || :.:...:..||:.:|      :.||:    |:|.:.:..:::|...|..|..:         
Yeast   296 ALKDKSCRKIAGRPLRMEYGEDRSKRQVR----KKVENVSRNNSSSFDISNNKGYD--------- 347

  Fly   374 LDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKSNDQQTALAKKIAPKQ 433
               :.|::||| |.|     .|:.:..|...||...:.|.....:..|:.:.|  |.|.|
Yeast   348 ---RAGQDNGS-KPE-----YKRSNANRRPPVDSNNRTKSSVALATAQRGSAA--IVPSQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/101 (22%)
RRM_SF 261..332 CDD:302621 24/72 (33%)
NOP13NP_014224.2 RRM1_Nop13p_fungi 127..217 CDD:409830 22/104 (21%)
RRM2_Nop13p_fungi 241..316 CDD:409831 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.