DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and NOP6

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_010068.1 Gene:NOP6 / 851313 SGDID:S000002372 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:369 Identity:74/369 - (20%)
Similarity:109/369 - (29%) Gaps:182/369 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAK 133
            :||..|||   ||.||.:.:.:|         |.:.|..|||           :.|:|   |:..
Yeast     6 DKKLTKKQ---LKAQQFRKSKEE---------KDQEKDVKKE-----------QAPEG---KRPN 44

  Fly   134 ANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHK 198
            :.|.|..||.||:                                                 |.|
Yeast    45 SAAGNDGEEPVKK-------------------------------------------------KRK 60

  Fly   199 QRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIF 263
            .|:..|                                         |:.|:   ..|..:..:|
Yeast    61 TRRGRG-----------------------------------------GKGKN---GKKGNRFIVF 81

  Fly   264 VGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQ-KPDAVG------LALELNQ 321
            ||||....|..:|:..|.:... |.||...|     ||:|::.|. ..|..|      :||..:.
Yeast    82 VGSLPRDITAVELQNHFKNSSP-DQIRLRAD-----KGIAFLEFDADKDRTGIQRRMDIALLQHG 140

  Fly   322 TLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSLK 386
            |||.::.||||                          .|.....||   ::||:|.|.|      
Yeast   141 TLLKEKKINVE--------------------------LTVGGGGNS---QERLEKLKNK------ 170

  Fly   387 KEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKSNDQQTALAKKIA 430
                           .:|:|..:|.:..|..::..|..:||..|
Yeast   171 ---------------NIKLDEERKERLTKMINDGNQKKIAKTTA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 4/81 (5%)
RRM_SF 261..332 CDD:302621 25/77 (32%)
NOP6NP_010068.1 NARP1 <1..55 CDD:403685 22/74 (30%)
RRM_Nop6 78..151 CDD:409834 25/78 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.