DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and PES4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_116678.1 Gene:PES4 / 850579 SGDID:S000001919 Length:611 Species:Saccharomyces cerevisiae


Alignment Length:528 Identity:105/528 - (19%)
Similarity:175/528 - (33%) Gaps:200/528 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KTPKAKESEKAELKPIKKEPGVVEDGKVTKKSKTKPKKKTV---------KVPKDEVKAAVQESP 57
            ::..:..|:..|...|.......::||:    |:...||.|         .|.::.:|...::.|
Yeast    55 RSSSSSHSDSPEFLRINNNKSGHKNGKL----KSFESKKLVPLFIGDLHETVTEETLKGIFKKYP 115

  Fly    58 KKLSAK-DLAKIEKK---------KAKKQAQKLKKQQN--KLAPKEIKTEPEAQ----------- 99
            ..:||| .|..:.||         :.|::|:|..::.|  |:..|||:..|..:           
Yeast   116 SFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTN 180

  Fly   100 -----------------------------------------VKVESKATKKEKV----------- 112
                                                     |..|.:.|.:..:           
Yeast   181 VFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTSFFGK 245

  Fly   113 --------EKEPTTAPN--------------EKPKGKVSKKAKANANNKDEEGVKRIRNPAEEAS 155
                    :||..:.||              ||.:....|.:|.|    |:|. |.|.:.::  :
Yeast   246 KILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKGN----DKES-KNIYSSSQ--N 303

  Fly   156 TVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQ 220
            ::|:.|||..|.|..::..|...|.::||.|..|          .||. .|.|:|..:....:::
Yeast   304 SIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNA----------TKVK-YLWAFVTYKNSSDSEK 357

  Fly   221 AL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCG 284
            |: ..|...|:...|.||         :|:||:      :|..|:.|.|.|..  .|..:.:.|.
Yeast   358 AIKRYNNFYFRGKKLLVT---------RAQDKE------ERAKFIESQKISTL--FLENLSAVCN 405

  Fly   285 E--IDYIRCLQDGDKGCK---------GVAYVCFQK----PDAVGLALELNQTLLD--------D 326
            :  :.|: |.|:..:..|         ...|..|.|    .||..:...||..|:.        :
Yeast   406 KEFLKYL-CHQENIRPFKIQIDGYDENSSTYSGFIKFRNFEDATRIFNFLNNRLVGGSIVTTSWE 469

  Fly   327 RPINVERY------------------------QVKKLGAKQVRDAAAASAASKTSSKTKAKNQNS 367
            |..|..:|                        ....|.:..:||  .:|..|.|.|..|.||.| 
Yeast   470 RQNNAPKYHDGYGMRNIHTSSHPQITPYYQYSHANSLNSPHMRD--LSSMNSSTRSLIKNKNFN- 531

  Fly   368 AGAKKRLD 375
               ||.|:
Yeast   532 ---KKVLE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 21/82 (26%)
RRM_SF 261..332 CDD:302621 20/93 (22%)
PES4NP_116678.1 PABP-1234 93..>461 CDD:130689 79/403 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.