DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and PAB8

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001185184.1 Gene:PAB8 / 841399 AraportID:AT1G49760 Length:671 Species:Arabidopsis thaliana


Alignment Length:262 Identity:65/262 - (24%)
Similarity:109/262 - (41%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 RNPAEEA---STVFVGNLPINTKRVQLVKLFQPYGLVQS-IRLRTAGGKQLFKHKQRKVAGSLNA 208
            |:|:.|.   :.|:|.||..:....:|.|:|..:|:..| :.:|...||.       |..|.:| 
plant   214 RDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKS-------KGFGFVN- 270

  Fly   209 YVVLEKPEIAQQAL-ALNGSEFKENHLRVTPA--------SMAEKFGQAKDKQPSDKDAKRTIFV 264
               .|..:.|.:|: ||||..|.:....|..|        .:.:||.|:. |:.:||.....::|
plant   271 ---FENSDDAARAVDALNGKTFDDKEWFVGKAQKKSERETELKQKFEQSL-KEAADKSQGSNLYV 331

  Fly   265 GSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLAL-ELNQTLLDDRP 328
            .:|..|.|:::|||.|:..|.|...:.::|.....:|..:|.|..|:....|: |:|..::..:|
plant   332 KNLDESVTDDKLREHFAPFGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITEMNGKMIVTKP 396

  Fly   329 INVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSLKKEGAPTG 393
            :.|                  |.|..|...|.:.:.|.|......:....|.........|.|.|
plant   397 LYV------------------ALAQRKEDRKARLQAQFSQMRPVNMPPAVGPRMQMYPPGGPPMG 443

  Fly   394 QK 395
            |:
plant   444 QQ 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/83 (28%)
RRM_SF 261..332 CDD:302621 19/71 (27%)
PAB8NP_001185184.1 PABP-1234 46..646 CDD:130689 65/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.