DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and RBP47C'

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_175181.1 Gene:RBP47C' / 841159 AraportID:AT1G47500 Length:434 Species:Arabidopsis thaliana


Alignment Length:217 Identity:55/217 - (25%)
Similarity:93/217 - (42%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GVKRIRNPAEEASTVFVGNLPINTKRVQLVKLF-QPYGLVQSIRLRTAGGKQLFKHKQRKVAGSL 206
            |.||:.|...:.| :|||:|..:.....|.:.| :.|..|::.::.....           .|..
plant   188 GEKRLENNGPDLS-IFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDAN-----------TGRS 240

  Fly   207 NAYVVL---EKPEIAQQALALNGSEFKENHLRVTPASMAEKFG--QAKDKQPSDKDAK------- 259
            ..|..:   ::.|..:....:||.:.....:|:.||:..:..|  |.....||....:       
plant   241 KGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTNGYQQQGGYMPSGAFTRSEGDTIN 305

  Fly   260 RTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLL 324
            .|||||.|..|.|:|.|::.||..|||..:: :..| |||..|.:|  .:|:|.....:||.|::
plant   306 TTIFVGGLDSSVTDEDLKQPFSEFGEIVSVK-IPVG-KGCGFVQFV--NRPNAEEALEKLNGTVI 366

  Fly   325 DDRPINVERYQVKKLGAKQVRD 346
            ..:.:.:.  ..:....||.||
plant   367 GKQTVRLS--WGRNPANKQPRD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 15/85 (18%)
RRM_SF 261..332 CDD:302621 26/70 (37%)
RBP47C'NP_175181.1 RRM1_SECp43_like 104..186 CDD:240790
RRM2_SECp43_like 198..277 CDD:240791 16/90 (18%)
RRM3_NGR1_NAM8_like 305..376 CDD:240792 26/76 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.