DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and RBM4B

DIOPT Version :10

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:192 Identity:42/192 - (21%)
Similarity:75/192 - (39%) Gaps:43/192 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 VFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQA 221
            :|:||||......::..||:.||.|....:....|   |.|.:.|.|              |:.|
Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYG---FVHIEDKTA--------------AEDA 51

  Fly   222 LALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEI 286
            :.      ..:|.::...::..:..:.|.|      |...:.||::..:.|.::||..|...|.:
Human    52 IR------NLHHYKLHGVNINVE
ASKNKSK------ASTKLHVGNISPTCTNQELRAKFEEYGPV 104

  Fly   287 DYIRCLQDGDKGCKGVAYVCFQK-PDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDA 347
              |.|     ...|..|:|..:: .|||.....|:.|....:.::|:      |...::|.|
Human   105 --IEC-----DIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQ------LSTSRLRTA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828 18/79 (23%)
RRM_SF 261..332 CDD:473069 17/71 (24%)
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018 18/86 (21%)
RRM2_RBM4 78..144 CDD:410019 17/72 (24%)
PTZ00368 <145..>181 CDD:173561 3/9 (33%)
ZnF_C2HC 161..176 CDD:197667
Interaction with TNPO3. /evidence=ECO:0000250 196..359
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.