DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and CID13

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_197832.1 Gene:CID13 / 832515 AraportID:AT5G24440 Length:320 Species:Arabidopsis thaliana


Alignment Length:258 Identity:56/258 - (21%)
Similarity:89/258 - (34%) Gaps:77/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEAST 156
            :|.:......:::..|  ..||.:|:.:.::.||.|                           |:
plant     9 VKVDSSNNQNIDNNTT--SLVETKPSCSDDQTPKSK---------------------------SS 44

  Fly   157 VFVGNLPINTKRVQL----------VKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVV 211
            |....|...|..|.|          .|.|.|..|.|:......|.:..|.:              
plant    45 VLTNELIQRTSEVNLKSEISHLNPMAKEFVPSFLAQTHHSEFWGNRFWFTN-------------- 95

  Fly   212 LEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQA------KDKQPSDKD-AKRTIFVGSLKY 269
                ...:|.:.|.| :|         |:|...||:.      |.....::| .|||::|..:..
plant    96 ----HFPKQTIFLIG-QF---------ATMRRNFGKGRPWITKKTNLVQNEDMIKRTVYVSDIDN 146

  Fly   270 SATEEQLREIFSSCGEIDYIRCLQDGD-KGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINV 331
            ..|||||..:|.|||::  :.|...|| |.....|::.|...:....||..:.|:....||.|
plant   147 QVTEEQLASLFLSCGQV--VDCRMCGDYKSILRFAFIEFTDAEGARSALRKSGTMFGSHPIRV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 17/91 (19%)
RRM_SF 261..332 CDD:302621 23/72 (32%)
CID13NP_197832.1 PAM2 64..78 CDD:336618 3/13 (23%)
RRM1_CID8_like 135..214 CDD:240905 25/75 (33%)
RRM2_CID8_like 230..311 CDD:240906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.