DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AT5G03480

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_195968.1 Gene:AT5G03480 / 831825 AraportID:AT5G03480 Length:321 Species:Arabidopsis thaliana


Alignment Length:199 Identity:50/199 - (25%)
Similarity:89/199 - (44%) Gaps:36/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DEEGVKRIR----NPAEEAST---VFVGNLPINTK----RVQLVKLFQPYGLVQSIRLRTAGGKQ 193
            :|..:||::    |.:::.||   :.|.....:.|    |:.|.|.|...|.:..|.:     .:
plant     2 EESAIKRLKSLELNDSDKQSTSTAICVEGYDTSLKEYPLRLALTKHFASCGEITQIYV-----PR 61

  Fly   194 LFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDA 258
            .||   :|:..|: :::.::......:||.|:|::.....:.|.|        :.|.:.||   .
plant    62 DFK---KKILKSV-SFMWIKGEGAEDKALQLSGTDVGGWTVIVKP--------KPKHEPPS---P 111

  Fly   259 KRTIFV----GSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALE 318
            ..||.|    .||:....|..|.:.|.|||||.::....|.::| .|.||::..:...|...||:
plant   112 ITTISVEGYDTSLQKYLLELILEKHFDSCGEIRHVYVPTDYERGVLKSVAFLRIEGEGAEDKALQ 176

  Fly   319 LNQT 322
            |:.|
plant   177 LSGT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 18/88 (20%)
RRM_SF 261..332 CDD:302621 23/67 (34%)
AT5G03480NP_195968.1 RRM_SF 26..102 CDD:302621 17/84 (20%)
RRM_SF 114..192 CDD:302621 23/67 (34%)
RRM_SF 217..284 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.