DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AT5G10350

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_196597.1 Gene:AT5G10350 / 830899 AraportID:AT5G10350 Length:217 Species:Arabidopsis thaliana


Alignment Length:131 Identity:44/131 - (33%)
Similarity:71/131 - (54%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 EIAQQALALNGSEFK-ENHLRVT--PASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLR 277
            |:.::|.||...:.| |..:..|  |||||     |..:...:.|| |:::||::.|:.|.|:::
plant    48 EMEEEAAALREMQAKVEKEMGATQDPASMA-----ANQEGKEEVDA-RSVYVGNVDYACTPEEVQ 106

  Fly   278 EIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAK 342
            ..|.:||.::.:..|.|.....||.|||.|.:.:||..||:||::.|..|.:.|...:....|.|
plant   107 LHFQTCGTVNRVTILMDKFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGMK 171

  Fly   343 Q 343
            |
plant   172 Q 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 6/21 (29%)
RRM_SF 261..332 CDD:302621 24/70 (34%)
AT5G10350NP_196597.1 PIN_SF <6..70 CDD:421694 6/21 (29%)
RRM <47..>212 CDD:223796 44/131 (34%)
RRM_II_PABPs 90..161 CDD:409747 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.