DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AT4G12640

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_193001.2 Gene:AT4G12640 / 826877 AraportID:AT4G12640 Length:823 Species:Arabidopsis thaliana


Alignment Length:279 Identity:63/279 - (22%)
Similarity:109/279 - (39%) Gaps:66/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 EEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQL----FKHKQRK 201
            |:|  |.|||  .:..::|||||......:|...|..:|.::|:..:.  |:..    |.|.:..
plant    13 EDG--RGRNP--PSRHLWVGNLPHGILERELADRFLRFGELESLAFQP--GRSYAFVNFNHDEDA 71

  Fly   202 VAG--SLNAYVVLEKP---EIA------------------QQALALNGSEFKENHLRV---TPAS 240
            .|.  ||..:.:...|   |.|                  :|..|..||.|.:...|:   :|.:
plant    72 FAAIESLQGFPLSGNPLRIEFAKAEKSSTGSRTDDIYRHDEQRSAARGSSFVQRDSRMRYESPDT 136

  Fly   241 MAEKFGQAKDKQPSDKDAKRTIFVG---SLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGV 302
            .::.....::.:||:     .:::|   |||  ..:..||.:|||.|||..:.....     :..
plant   137 YSKSKMNDRNAEPSE-----VLYIGFPASLK--VDDALLRNVFSSFGEITKVTVFPG-----RSY 189

  Fly   303 AYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNS 367
            |:|.|:...|   |.:..::|           |.|..|..:|....|.|..|.:.|......::.
plant   190 AFVQFRNLMA---ACKAKESL-----------QGKLFGNPRVHICFAKSEPSSSGSGRGPSGRSL 240

  Fly   368 AGAKKRLDKKKGKENGSLK 386
            :...:.:| :.|...|.|:
plant   241 SPPYRSVD-RLGSSEGYLQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/111 (22%)
RRM_SF 261..332 CDD:302621 18/73 (25%)
AT4G12640NP_193001.2 RRM3_Spen 25..94 CDD:240756 17/70 (24%)
RRM_SF 153..223 CDD:302621 22/90 (24%)
SPOC 471..567 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.