DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and CID9

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_188063.1 Gene:CID9 / 820668 AraportID:AT3G14450 Length:327 Species:Arabidopsis thaliana


Alignment Length:334 Identity:74/334 - (22%)
Similarity:130/334 - (38%) Gaps:62/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VVEDGKVTKKSKTKPKKKTVK-VPKDEVKAAVQESPKKLSAKDLAKIEKK-------------KA 73
            ||:|   .|:..||.:|...: :.|..:..:..|:..:|....|..:.||             ..
plant    13 VVDD---VKEVSTKSEKIIDEGIEKSSITDSKTETESRLDMHKLVAMFKKLNPLAKEFFPSYYDP 74

  Fly    74 KKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKP-KGKVSKKAKANAN 137
            ||..|..|..|...|.....|:.::..:.:..|.|.:...|....:...:. .|::||..:    
plant    75 KKNNQVAKANQFLPADDFETTKKQSGEEFDLDAKKDDNTRKRRNYSQGRRRLTGRISKAQR---- 135

  Fly   138 NKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKV 202
               |:.::|         ||:|.::..:.....|..||...|  |.:..|..|.    .|...:.
plant   136 ---EDSIRR---------TVYVSDIDQSVTEEGLAGLFSNCG--QVVDCRICGD----PHSVLRF 182

  Fly   203 AGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMA-----EKFGQAKDKQPSDKDAK--- 259
                 |:|.....:.|.:||:|.|:......:||.|:..|     ..|      .|..:|.:   
plant   183 -----AFVEFADDQGAHEALSLGGTMLGFYPVRVLPSKTAILPVNPTF------LPRSEDEREMC 236

  Fly   260 -RTIFVGSLKYSATEEQLREIF-SSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQT 322
             |||:..::....::..:|..| |:|||:..:|.|.|.....: :|:|.|...|:...||..:..
plant   237 TRTIYCTNIDKKVSQADVRNFFESACGEVTRLRLLGDQLHSTR-IAFVEFALADSALSALNCSGM 300

  Fly   323 LLDDRPINV 331
            ::..:||.|
plant   301 VVGSQPIRV 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 19/81 (23%)
RRM_SF 261..332 CDD:302621 20/72 (28%)
CID9NP_188063.1 PAM2 55..72 CDD:284542 2/16 (13%)
RRM1_CID8_like 139..218 CDD:240905 22/98 (22%)
RRM2_CID8_like 234..315 CDD:240906 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.