DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AT3G14100

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_188026.1 Gene:AT3G14100 / 820626 AraportID:AT3G14100 Length:427 Species:Arabidopsis thaliana


Alignment Length:350 Identity:76/350 - (21%)
Similarity:119/350 - (34%) Gaps:108/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EKKKAKKQAQKLKKQQN-----KLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKV 128
            ::::|..|.|.|.:|.:     .|||.::                      ||.      |.|.:
plant    13 QQQQAMMQQQALMQQHSLYHPGVLAPPQL----------------------EPV------PSGNL 49

  Fly   129 SKKAKANANNKDEEGVKRIRNPAEEAST---VFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAG 190
            .                    |..:.||   |:|||:........|.::|...|.|:|.:|    
plant    50 P--------------------PGFDPSTCRSVYVGNIHTQVTEPLLQEIFTSTGPVESSKL---- 90

  Fly   191 GKQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSD 255
                    .||...|.......::...|...|:|||     .||...|..:...:...   |..|
plant    91 --------IRKDKSSYGFVHYFDRRSAALAILSLNG-----RHLFGQPIKVNWAYATG---QRED 139

  Fly   256 KDAKRTIFVGSLKYSATEEQLRE---IFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLA 316
            ..:...||||.|....|:..|.:   :||||.:   .|.:.|...| .:|..:|.|:        
plant   140 TSSHFNIFVGDLSPEVTDATLYQSFSVFSSCSD---ARVMWDQKTGRSRGFGFVSFR-------- 193

  Fly   317 LELNQTLLDDRPINVERYQVKKLGAKQVR----DAAAASAASKTSSKTKAKNQNSAGAKKRLDKK 377
               ||   .|....:.....|.|.::|:|    ...|.|...|.||..|:..:.:.|:     .:
plant   194 ---NQ---QDAQTAINEMNGKWLSSRQIRCNWATKGATSGDDKLSSDGKSVVELTTGS-----SE 247

  Fly   378 KGKENGSLKKEGAPTGQKKKSEYRG 402
            .|||  :|.:|......:..:.|.|
plant   248 DGKE--TLNEETPENNSQFTTVYVG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/84 (26%)
RRM_SF 261..332 CDD:302621 20/74 (27%)
AT3G14100NP_188026.1 RRM1_TIA1_like 61..131 CDD:240798 21/86 (24%)
ELAV_HUD_SF 70..323 CDD:273741 56/244 (23%)
RRM2_PUB1 145..219 CDD:241063 24/90 (27%)
RRM3_TIA1_like 265..340 CDD:240800 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.