DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and PAB7

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_181204.1 Gene:PAB7 / 818238 AraportID:AT2G36660 Length:609 Species:Arabidopsis thaliana


Alignment Length:337 Identity:78/337 - (23%)
Similarity:138/337 - (40%) Gaps:62/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VPKDEVKAAVQESPKK----LSAKDLAKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVES 104
            :|:....|.:|:..||    :|.| :|.:|..|::... .::.:|...|...|:|.....|    
plant   119 LPESVTNAVLQDMFKKFGNIVSCK-VATLEDGKSRGYG-FVQFEQEDAAHAAIQTLNSTIV---- 177

  Fly   105 KATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRV 169
                          |..|...||..||            ..|:: |.|:.:.:::.||..:....
plant   178 --------------ADKEIYVGKFMKK------------TDRVK-PEEKYTNLYMKNLDADVSED 215

  Fly   170 QLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQAL-ALNGSEFKENH 233
            .|.:.|..:|.:.|:.:.        |.:.|...|  .|:|..:.||.|::|. .:||::|....
plant   216 LLREKFAEFGKIVSLAIA--------KDENRLCRG--YAFVNFDNPEDARRAAETVNGTKFGSKC 270

  Fly   234 LRVTPAS--------MAEKFGQAKDKQPSDKDAKR--TIFVGSLKYSATEEQLREIFSSCGEIDY 288
            |.|..|.        :.|:|   |:|....|...:  .|:|.::..:.|||:||:.||.||.|..
plant   271 LYVGRAQKKAEREQLLREQF---KEKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGTITS 332

  Fly   289 IRCLQDGDKGCKGVAYVCFQKP-DAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASA 352
            .:.:.|.....||..:|||..| :|:......:..:...:|:.|...|.|:....|::.......
plant   333 TKLMCDEKGKSKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYVAIAQKKEDRKMQLQVQFGNRV 397

  Fly   353 ASKTSSKTKAKN 364
            .::.||.:.:.|
plant   398 EARKSSSSASVN 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 19/82 (23%)
RRM_SF 261..332 CDD:302621 21/71 (30%)
PAB7NP_181204.1 PABP-1234 24..582 CDD:130689 78/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.