DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and tia1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_997793.1 Gene:tia1 / 793165 ZFINID:ZDB-GENE-030131-1506 Length:386 Species:Danio rerio


Alignment Length:235 Identity:57/235 - (24%)
Similarity:91/235 - (38%) Gaps:58/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 EEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRL--RTAGGK-----QLFKHKQRKVAGSLNAY 209
            |:..|::||||..:.....:::||...|..:|.::  .|||..     :.|:|  |..|.||   
Zfish     5 EQPKTLYVGNLSRDVTEALIMQLFGQIGPCKSCKMIVDTAGNDPYCFVEFFEH--RHAAASL--- 64

  Fly   210 VVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEE 274
                        .|:||.:.....::|..|:       :...|..|......:|||.|....|.:
Zfish    65 ------------AAMNGRKIMGKEVKVNWAT-------SPSSQKKDTSNHFHVFVGDLSPEITTD 110

  Fly   275 QLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVC-FQKPDAVGLALELNQTLLDDRPINVERYQVK 337
            .:|..|:..|.|...|.::|...| .||..:|. |.|.||...               :::...:
Zfish   111 DIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENA---------------IQQMGGQ 160

  Fly   338 KLGAKQVRD--AAAASAASKTSSKTKAK--------NQNS 367
            .||.:|:|.  |.....|.|.:.:|..|        ||:|
Zfish   161 WLGGRQIRTNWATRKPPAPKATYETNTKHLSFDEVVNQSS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 21/88 (24%)
RRM_SF 261..332 CDD:302621 19/72 (26%)
tia1NP_997793.1 ELAV_HUD_SF 6..270 CDD:273741 56/234 (24%)
RRM1_TIA1 9..82 CDD:241059 22/89 (25%)
RRM2_TIA1 95..174 CDD:241062 24/93 (26%)
RRM3_TIA1 204..277 CDD:241065
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.