DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Hnrnpd

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_077380.2 Gene:Hnrnpd / 79256 RGDID:620365 Length:353 Species:Rattus norvegicus


Alignment Length:273 Identity:62/273 - (22%)
Similarity:103/273 - (37%) Gaps:70/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TAPNEKPKGKV-SKKAKANAN-NKDEEGVKRIRNPAEEAST-------VFVGNLPINTKRVQLVK 173
            :||.....|.. ::.||.:|: |:::||.........||:|       :|:|.|..:|.:..|..
  Rat    49 SAPGGTEGGSTEAEGAKIDASKNEEDEGHSNSSPRHTEAATAQREEWKMFIGGLSWDTTKKDLKD 113

  Fly   174 LFQPYGLVQSIRL-------RTAG-GKQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFK 230
            .|..:|.|....|       |:.| |..|||..:.           ::|        .::..|.|
  Rat   114 YFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESES-----------VDK--------VMDQKEHK 159

  Fly   231 ENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDG 295
            .|...:.|    ::....|.|:|..|     ||||.|.....||::||.|...||::.|....|.
  Rat   160 LNGKVIDP----KRAKAMKTKEPVKK-----IFVGGLSPDTPEEKIREYFGGFGEVESIELPMDN 215

  Fly   296 DKG-CKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTS-S 358
            ... .:|..::.|:                       |...|||:..|:..:...:....|.: |
  Rat   216 KTNKRRGFCFITFK-----------------------EEEPVKKIMEKKYHNVGLSKCEIKVAMS 257

  Fly   359 KTKAKNQNSAGAK 371
            |.:.:.|...|::
  Rat   258 KEQYQQQQQWGSR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 20/96 (21%)
RRM_SF 261..332 CDD:302621 16/71 (23%)
HnrnpdNP_077380.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 11/39 (28%)
CBFNT <55..76 CDD:285369 5/20 (25%)
RRM1_hnRNPD_like 97..170 CDD:241019 20/95 (21%)
RRM2_hnRNPD 181..255 CDD:241027 23/101 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.