DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and TIA1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_071505.2 Gene:TIA1 / 7072 HGNCID:11802 Length:386 Species:Homo sapiens


Alignment Length:243 Identity:58/243 - (23%)
Similarity:96/243 - (39%) Gaps:63/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 EEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIR--LRTAGGKQ---LFKHKQRKVAGSLNAYVV 211
            |...|::||||..:.....:::||...|..::.:  :.|||...   :..|:.|..|.:|     
Human     4 EMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAAL----- 63

  Fly   212 LEKPEIAQQALALNGSEFKENHLRV----TPASMAEKFGQAKDKQPSD-KDAKRT-----IFVGS 266
                      .|:||.:.....::|    ||:|      |.||...|. ...:|:     :|||.
Human    64 ----------AAMNGRKIMGKEVKVNWATTPSS------QKKDTSSSTVVSTQRSQDHFHVFVGD 112

  Fly   267 LKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVC-FQKPDAVGLALELNQTLLDDRPI 329
            |....|.|.::..|:..|.|...|.::|...| .||..:|. |.|.||...              
Human   113 LSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENA-------------- 163

  Fly   330 NVERYQVKKLGAKQVRD--AAAASAASKTSSKTKAK--------NQNS 367
             :::...:.||.:|:|.  |.....|.|::.::..|        ||:|
Human   164 -IQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 19/90 (21%)
RRM_SF 261..332 CDD:302621 19/77 (25%)
TIA1NP_071505.2 RRM1_TIA1 8..81 CDD:410027 19/87 (22%)
RRM2_TIA1 104..181 CDD:410030 23/91 (25%)
RRM3_TIAR 214..286 CDD:241064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..386
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.