DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Dazap1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001365924.1 Gene:Dazap1 / 70248 MGIID:1917498 Length:407 Species:Mus musculus


Alignment Length:223 Identity:51/223 - (22%)
Similarity:91/223 - (40%) Gaps:31/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AEEASTVFVGNLPINTKRVQLVKLFQPYG------LVQSIRLRTAGGKQLFKHKQRKVAGSLNAY 209
            |:|...:|||.|..:|.:..|...|..||      :::......:.|....|.|.....|::   
Mouse     6 ADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTV--- 67

  Fly   210 VVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKD---KQP-SDKDAKRTIFVGSLKYS 270
                   :|.:...|:|......  ..||..|..:..:.|:   |.| ||......||||.:.::
Mouse    68 -------LASRPHTLDGRNIDPK--PCTPRGMQPERTRPKEGWQKGPRSDSSKSNKIFVGGIPHN 123

  Fly   271 ATEEQLREIFSSCGEIDYIRCLQDGDK-GCKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERY 334
            ..|.:|||.|...|.:..:..:.|.:| ..:|..::.|:...:|..|:.::...:..:.:.|:|.
Mouse   124 CGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRA 188

  Fly   335 QVK--------KLGAKQVRDAAAASAAS 354
            :.:        :.||.|.....|.|||:
Mouse   189 EPRDSKNQAPGQPGASQWGSRVAPSAAN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/87 (18%)
RRM_SF 261..332 CDD:302621 16/71 (23%)
Dazap1NP_001365924.1 RRM1_DAZAP1 11..92 CDD:409988 19/92 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..117 11/44 (25%)
RRM2_DAZAP1 111..190 CDD:409765 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.