Sequence 1: | NP_609822.1 | Gene: | CG12288 / 35027 | FlyBaseID: | FBgn0032620 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001365924.1 | Gene: | Dazap1 / 70248 | MGIID: | 1917498 | Length: | 407 | Species: | Mus musculus |
Alignment Length: | 223 | Identity: | 51/223 - (22%) |
---|---|---|---|
Similarity: | 91/223 - (40%) | Gaps: | 31/223 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 AEEASTVFVGNLPINTKRVQLVKLFQPYG------LVQSIRLRTAGGKQLFKHKQRKVAGSLNAY 209
Fly 210 VVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKD---KQP-SDKDAKRTIFVGSLKYS 270
Fly 271 ATEEQLREIFSSCGEIDYIRCLQDGDK-GCKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERY 334
Fly 335 QVK--------KLGAKQVRDAAAASAAS 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12288 | NP_609822.1 | RRM1_RBM34 | 155..237 | CDD:240840 | 16/87 (18%) |
RRM_SF | 261..332 | CDD:302621 | 16/71 (23%) | ||
Dazap1 | NP_001365924.1 | RRM1_DAZAP1 | 11..92 | CDD:409988 | 19/92 (21%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 74..117 | 11/44 (25%) | |||
RRM2_DAZAP1 | 111..190 | CDD:409765 | 18/78 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |