DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Spen

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_038966732.1 Gene:Spen / 690911 RGDID:1589867 Length:3632 Species:Rattus norvegicus


Alignment Length:567 Identity:115/567 - (20%)
Similarity:197/567 - (34%) Gaps:171/567 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PKAKESEKAE----------LKPIKKEPGVVEDGKVTKK--SKTKPKKKTVKVP--KD--EVKAA 52
            |.|..:||||          .:|.:..| |:|:.|:..:  |::..::|.|.:.  ||  :..|.
  Rat  1646 PPAAAAEKAEETSEAPSLAGERPEEPTP-VLEETKLVSEPPSESVEQRKQVDLSPGKDSHDSTAV 1709

  Fly    53 VQESPKKLSAKDLAKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPT 117
            |..:|.:.:..|.......:.......:.:.::...||....:|.:::....:..::.|||:..|
  Rat  1710 VASTPPESTTTDTVPCVDAEPLTPGTTVSQVESSADPKPSSPQPPSKLTQRCEEAEEPKVERPET 1774

  Fly   118 TA-------------PNEKPKGKVSKKAKANANNKDEEGVKRIRN----PAEEASTVFVGNLPIN 165
            ||             |..:|......:|......||.:..|..|:    ||..||.|   ..|:.
  Rat  1775 TASIEPDATEKAEVVPEVQPPASEDVEASPPVTAKDRKTTKSKRSKTSVPAAAASIV---EKPVT 1836

  Fly   166 TK-----RVQLVKLFQPYGLVQSIR---------LRTA----GGK--------QLFKHKQRKVAG 204
            .|     |.::.:...|.|..|.:.         .|||    ||.        .|.:.::|.|. 
  Rat  1837 RKSERIDREKMKRSSSPRGEAQKLLELKMEADKVTRTASKSSGGDTEHPEPSLPLSRTRRRNVR- 1900

  Fly   205 SLNAYVVL-------------EKPEIAQQALALNGSEFKENHLR---VTPAS-----------MA 242
              :.|..:             |:|.:.::.|        |..|:   |.||:           ..
  Rat  1901 --SVYATMGDHESRSPAKEPTEQPRVTRKRL--------ERELQEAVVVPATPRRGRPPKTRRRV 1955

  Fly   243 EKFGQAKDKQPSD--KDAKRTIFVGSLKYSAT---------EEQLREIFSSCGEIDYIRCLQDGD 296
            |:.|:.:.|:|:|  :.|:......|.|.:||         .|...|...:..::.    .::|:
  Rat  1956 EEGGEQERKEPADTPRPAEGRRSPRSQKLAATGGPQGKRGRNEHRAEAAEATAQVS----AREGN 2016

  Fly   297 KGCKGVAYVCFQKPDAVGLALELNQTLLDDR------------PINVER------YQVKKLGAKQ 343
            ...:|.....             ::|..|.:            |:.|||      |:.|:..|:.
  Rat  2017 AKARGDREAA-------------SETRRDRKDPSTDKDGPDIFPVEVERKPPEKTYKSKRGRARS 2068

  Fly   344 VR---DAA--------AASAASKTSSKTKA---KNQN---SAGAKKRL-------DKKKGKENGS 384
            .|   |.|        |..||.|.:....|   ||::   .:|...:|       ||:..||:.|
  Rat  2069 TRSGMDRAAHLKSLEMARQAADKEAEPVAASPEKNESPLEGSGVSPQLADNPADPDKEAEKESVS 2133

  Fly   385 LKKEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKSNDQQTALAKKIAP 431
            .........|..|.......|:.|.|..:|...:.|:.||.|....|
  Rat  2134 ASTVSPEARQLTKQMELQQAVENIAKLAEPSAAAADKGTATATSEEP 2180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/123 (18%)
RRM_SF 261..332 CDD:302621 11/91 (12%)
SpenXP_038966732.1 RRM1_SHARP 7..81 CDD:409784
RRM2_SHARP 336..409 CDD:409785
RRM3_SHARP 436..509 CDD:409786
RRM4_SHARP 510..586 CDD:409787
RRM <512..671 CDD:223796
PTZ00121 <773..1252 CDD:173412
PTZ00449 <1529..1983 CDD:185628 71/351 (20%)
PTZ00121 <1760..>2333 CDD:173412 92/452 (20%)
PHA03247 <2178..2711 CDD:223021 1/3 (33%)
Collagen_mid <2630..>2723 CDD:406398
Herpes_BLLF1 <2669..3118 CDD:282904
PHA03247 <3081..3468 CDD:223021
SPOC 3469..3632 CDD:400205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.