DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Puf60

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_030104578.1 Gene:Puf60 / 67959 MGIID:1915209 Length:598 Species:Mus musculus


Alignment Length:317 Identity:68/317 - (21%)
Similarity:117/317 - (36%) Gaps:86/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVA 203
            |..:|.:.|:....:::...:|..|:..::.:.::..:.|.:.|||  ::...||...|:|:::.
Mouse    73 KPPQGTESIKMENGQSTGTKLGLPPLTPEQQEALQKAKKYAMEQSI--KSVLVKQTIAHQQQQLT 135

  Fly   204 GSLNAYVVLE--------KPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKR 260
            ....|.|.:.        :...||:..||              |.|..                 
Mouse   136 NLQMAAVTMGFGDPLSPLQSMAAQRQRAL--------------AIMCR----------------- 169

  Fly   261 TIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDG-DKGCKGVAYVCFQKPDAVGLALE-LNQTL 323
             ::|||:.|...|:.:|:.|:..|.|..|....|. ....||.|:|.::.|:|..|||| :|..:
Mouse   170 -VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVM 233

  Fly   324 LDDRPINVERYQVKKLG-AKQVRDAAAASAAS--------------------------KTSSKTK 361
            |..|.|.|.|  ...:| |:.:.|..|..|.:                          |..|.|.
Mouse   234 LGGRNIKVGR--PSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTL 296

  Fly   362 AKNQNSAGAKKRLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDG----IKKAKKP 414
            |::..:.         |.|..|.::.|.|.:.|...|......:.|    :.||..|
Mouse   297 ARDPTTG---------KHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/89 (18%)
RRM_SF 261..332 CDD:302621 25/72 (35%)
Puf60XP_030104578.1 half-pint 41..598 CDD:130706 68/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.