DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Rbm7

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_659197.2 Gene:Rbm7 / 67010 MGIID:1914260 Length:265 Species:Mus musculus


Alignment Length:77 Identity:28/77 - (36%)
Similarity:43/77 - (55%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 DAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LN 320
            :|.||:|||:|:...|||.|.|:|...|.:..::..:|.|...|..|:|.|:...:|..|:. ||
Mouse     7 EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQFAFVNFKHEVSVPYAMNLLN 71

  Fly   321 QTLLDDRPINVE 332
            ...|..|||.::
Mouse    72 GIKLFGRPIKIQ 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840
RRM_SF 261..332 CDD:302621 26/71 (37%)
Rbm7NP_659197.2 RRM <9..>101 CDD:223796 27/75 (36%)
RRM_RBM7 9..83 CDD:241036 27/73 (37%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 59..76 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.