DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12288 and Rbm7

DIOPT Version :9

Sequence 1:	NP_609822.1	Gene:	CG12288 / 35027	FlyBaseID:	FBgn0032620	Length:	435	Species:	Drosophila melanogaster
Sequence 2:	NP_659197.2	Gene:	Rbm7 / 67010	MGIID:	1914260	Length:	265	Species:	Mus musculus

Alignment Length:	77	Identity:	28/77 - (36%)
Similarity:	43/77 - (55%)	Gaps:	1/77 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   257 DAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LN 320
            :|.||:|||:|:...|||.|.|:|...|.:..::..:|.|...|..|:|.|:...:|..|:. ||
Mouse     7 EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQFAFVNFKHEVSVPYAMNLLN 71

  Fly   321 QTLLDDRPINVE 332
            ...|..|||.::
Mouse    72 GIKLFGRPIKIQ 83

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12288	NP_609822.1	RRM1_RBM34	155..237	CDD:240840
CG12288	NP_609822.1	RRM_SF	261..332	CDD:302621	26/71 (37%)
Rbm7	NP_659197.2	RRM	<9..>101	CDD:223796	27/75 (36%)
		RRM_RBM7	9..83	CDD:241036	27/73 (37%)
		ZCCHC8 binding. /evidence=ECO:0000250\|UniProtKB:Q9Y580	25..35		3/9 (33%)
		ZCCHC8 binding. /evidence=ECO:0000250\|UniProtKB:Q9Y580	59..76		4/16 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	91..125
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	166..224
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	237..265
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910