DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and PABPC1L2B

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001035971.1 Gene:PABPC1L2B / 645974 HGNCID:31852 Length:200 Species:Homo sapiens


Alignment Length:218 Identity:58/218 - (26%)
Similarity:93/218 - (42%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRL-------RTAGGKQLFKHKQRKVAGSLNAYVVL 212
            ::::||:|........|.:.|.|.|.:.|||:       |:.|                .|||..
Human     2 ASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLG----------------YAYVNY 50

  Fly   213 EKPEIAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPS-DKDAKRTIFVGSLKYSATEEQ 275
            ::|..|::|| .||....|...:|:          ....:.|| .|.....:|:.:|..:...:.
Human    51 QQPVDAKRALETLNFDVIKGRPVRI----------MWSQRDPSLRKSGVGNVFIKNLGKTIDNKA 105

  Fly   276 LREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERYQVKKL 339
            |..|||:.|.|...:...| :||.||..:|.|||.::...|:: :|...|:.|.|.|.|::..| 
Human   106 LYNIFSAFGNILSCKVACD-EKGPKGYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHK- 168

  Fly   340 GAKQVRDA-AAASAASKTSSKTK 361
                .|:| ..|.|...||:..|
Human   169 ----EREAERGAWARQSTSADVK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/89 (26%)
RRM_SF 261..332 CDD:302621 22/71 (31%)
PABPC1L2BNP_001035971.1 PABP-1234 2..>196 CDD:130689 58/218 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..200 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.