DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and SRSF4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_005617.2 Gene:SRSF4 / 6429 HGNCID:10786 Length:494 Species:Homo sapiens


Alignment Length:326 Identity:61/326 - (18%)
Similarity:120/326 - (36%) Gaps:71/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 VFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEI--AQ 219
            |::|.|....:...:.:.|:.||.:..:.|:                   |.|..:|..::  |.
Human     4 VYIGRLSYQARERDVERFFKGYGKILEVDLK-------------------NGYGFVEFDDLRDAD 49

  Fly   220 QAL-ALNGSEFKENHLRVTPASMAEKFG-------------QAKDKQPSDKDAKRTIFVGSLKYS 270
            .|: .|||.:.....:.|..|....:.|             ..:||.......:..:.|.:|...
Human    50 DAVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDK
YGPPTRTEYRLIVENLSSR 114

  Fly   271 ATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LNQT--------LLDD 326
            .:.:.|::.....||:.|    .|..||.|....:.|.....:..||| |:.|        |::|
Human   115 CSWQDLKDYMRQAGEVTY----ADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVED 175

  Fly   327 RPINVER--------YQVKKLGAKQVRDAAAASAASKTS---------------SKTKAKNQNSA 368
            :|.:..|        :...:..::..|.:.:.|.:||:|               ||:::::|:.:
Human   176 KPGSRRRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS 240

  Fly   369 GAKKRLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKSNDQQTALAKKIAPKQ 433
            .:||...:...||....:...|...:.|..:....|:.......|||.:|..:..:.:|..:..|
Human   241 RSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKSRSRSQ 305

  Fly   434 K 434
            :
Human   306 E 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 15/82 (18%)
RRM_SF 261..332 CDD:302621 19/79 (24%)
SRSF4NP_005617.2 RRM1_SRSF4_like 3..72 CDD:240783 17/86 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..95 1/22 (5%)
RRM2_SRSF4_like 104..175 CDD:241044 17/74 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..494 25/138 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.