DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and elavl2

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_012819022.1 Gene:elavl2 / 594913 XenbaseID:XB-GENE-491749 Length:390 Species:Xenopus tropicalis


Alignment Length:297 Identity:66/297 - (22%)
Similarity:119/297 - (40%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ANANNKDEEGVKRIRNPAEEAST------VFVGNLPINTKRVQLVKLFQPYGLVQSIRL---RTA 189
            ||..|.    :....:|.|.::|      :.|..||.|..:.:|..||...|.::|.:|   :..
 Frog    44 ANCPNT----INNCSSPVESSNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 104

  Fly   190 GGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQP 253
            .|:.|       ..|.:| |:   .|:.|::|: .|||...:...::|:         .|:....
 Frog   105 EGQSL-------GYGFVN-YI---DPKDAEKAINTLNGLRLQTKTIKVS---------YARPSSA 149

  Fly   254 SDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLAL 317
            |.:||  .::|..|..:.|:::|.::||..|.|...|.|.|...| .:||.::.|.|      .:
 Frog   150 SIRDA--NLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDK------RI 206

  Fly   318 ELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKT------KAKNQNSAG------A 370
            |..:.:   :.:|.:    |..||.:......|:..|:..:.|      ::.|:...|      .
 Frog   207 EAEEAI---KGLNGQ----KPPGATEPITVKFANNPSQKVNHTILSQLYQSPNRRYPGPLAQQAQ 264

  Fly   371 KKRLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDG 407
            :.|||.......|.:|...:|......:...|:...|
 Frog   265 RFRLDNLLNMAYGGIKSRFSPMTIDGMTSLAGINFPG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/91 (24%)
RRM_SF 261..332 CDD:302621 18/71 (25%)
elavl2XP_012819022.1 ELAV_HUD_SF 64..389 CDD:273741 60/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.