Sequence 1: | NP_609822.1 | Gene: | CG12288 / 35027 | FlyBaseID: | FBgn0032620 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002887.2 | Gene: | RBM4 / 5936 | HGNCID: | 9901 | Length: | 364 | Species: | Homo sapiens |
Alignment Length: | 345 | Identity: | 64/345 - (18%) |
---|---|---|---|
Similarity: | 106/345 - (30%) | Gaps: | 141/345 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 VFVGNLPINTKRVQLVKLFQPYGLV--------------------------------QSIRLRTA 189
Fly 190 GGKQLFKHKQRKVAGSLN---------------------------AYVVLEKPEIAQQAL-ALNG 226
Fly 227 SEFKENHLRV--------TPASMAE--------KFGQAKDKQPSDKD---------------AKR 260
Fly 261 TIFV----GSLKYSATEEQLREIFSSCGEID--YIRCLQDGDKGCKGVA-----------YVCFQ 308
Fly 309 KPDA--VGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAK 371
Fly 372 KRLDKKKGKENGSLKKEGAP 391 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12288 | NP_609822.1 | RRM1_RBM34 | 155..237 | CDD:240840 | 23/147 (16%) |
RRM_SF | 261..332 | CDD:302621 | 18/89 (20%) | ||
RBM4 | NP_002887.2 | RRM1_RBM4 | 2..68 | CDD:410018 | 10/63 (16%) |
RRM2_RBM4 | 78..144 | CDD:410019 | 10/65 (15%) | ||
PTZ00368 | <145..>181 | CDD:173561 | 6/35 (17%) | ||
ZnF_C2HC | 161..176 | CDD:197667 | 2/14 (14%) | ||
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 | 196..364 | 35/153 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |