DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and RBM3

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens


Alignment Length:151 Identity:34/151 - (22%)
Similarity:63/151 - (41%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD-KGCKGVAYVCFQKPDAVGLAL 317
            |.::.|  :|||.|.::..|:.|.:.|||.|.|..:..::|.: :..:|..::.|..|:...:|:
Human     2 SSEEGK--LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAM 64

  Fly   318 E-LNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKE 381
            . :|...||.|.|.|:.......|.:    .....|..:..|.::.......|:.:..|.:.|  
Human    65 RAMNGESLDGRQIRVDHAGKSARGTR----GGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPG-- 123

  Fly   382 NGSLKKEGAPTGQKKKSEYRG 402
                   |...|..:..:|.|
Human   124 -------GYGYGYGRSRDYNG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840
RRM_SF 261..332 CDD:302621 21/72 (29%)
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 23/80 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 10/70 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.