DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and hnrnpd

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:280 Identity:64/280 - (22%)
Similarity:107/280 - (38%) Gaps:67/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TKKEKVEKEPTTAPNEKPKGK---VSKKAKANANNKDEEGVK--RIRNPAEEASTVFVGNLPINT 166
            ::::.:.::||....|...|:   ..:.:..|....:.||.|  ..:|..:|.. :|||.|..:|
Zfish     2 SEEQFLGEDPTMKMEENDDGEGFGEEQMSGDNGGQGEAEGSKIDASKNEEDEGK-MFVGGLSWDT 65

  Fly   167 KRVQLVKLFQPYGLVQSIRL-------RTAG-GKQLFKHKQRKVAGSLNAYVVLEKPEIAQQALA 223
            .:..|...|..:|.|....|       |:.| |..|||..:.           :|| .|.|:...
Zfish    66 TKKDLKDYFTKFGEVVDCTLKLDPLTGRSRGFGFVLFKEAES-----------VEK-VITQKEHK 118

  Fly   224 LNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDY 288
            |||..       :.|    :|....|.|:|..|     ||||.|.....||::||.|.:.||::.
Zfish   119 LNGKV-------IDP----KKAKAMKTKEPVKK-----IFVGGLSPDTPEEKIREYFDAYGEVES 167

  Fly   289 IRC-LQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASA 352
            |.. :::.....:|..::.|:                       |...|||:..|...:...:..
Zfish   168 IELPMENKTNKRRGFCFITFK-----------------------EEEPVKKIMEKMYHNIGLSKC 209

  Fly   353 ASKTS-SKTKAKNQNSAGAK 371
            ..|.: ||.:.:.|...|.:
Zfish   210 EVKVAMSKEQYQQQQQWGGR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/89 (26%)
RRM_SF 261..332 CDD:302621 15/71 (21%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369 9/50 (18%)
RRM1_hnRNPD_like 56..129 CDD:241019 24/95 (25%)
RRM2_hnRNPD 140..214 CDD:241027 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.